PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004516524.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 504aa    MW: 56110.9 Da    PI: 6.6385
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004516524.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92.1e-173986148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+v+++G g+W+++ +  g+ R++k+c++rw ++l
   XP_004516524.1 39 KGPWTSAEDAILVDYVRKHGEGNWNAVQKNSGLSRCGKSCRLRWANHL 86
                     79******************************************9986 PP

2Myb_DNA-binding49.78.3e-1692135146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E++l+++++ ++G++ W++ a++++ gRt++++k++w++
   XP_004516524.1  92 KGSFTADEEQLIAKLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4413486IPR017930Myb domain
SMARTSM007177.3E-153888IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-2938133IPR009057Homeodomain-like
PfamPF002494.1E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-234093IPR009057Homeodomain-like
CDDcd001673.51E-114186No hitNo description
PROSITE profilePS5129422.09487141IPR017930Myb domain
SMARTSM007173.0E-1591139IPR001005SANT/Myb domain
PfamPF002496.8E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2494139IPR009057Homeodomain-like
CDDcd001673.25E-1194135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MNQVKTENED DMQCNDQTRS QLNDEGNGGS VGGVVVLKKG PWTSAEDAIL VDYVRKHGEG  60
NWNAVQKNSG LSRCGKSCRL RWANHLRPNL KKGSFTADEE QLIAKLHSKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRTKRC QRAGLPVYPK EVRKRPFQEG QRGQGTGGIN DGDRGHHDFL  180
PKNNYEMHDA IFDNLNLKQN QGILPIAIVP ENPDISANSI LLNSFDSPPY CNSVPSALPN  240
HHHLRESTMP FLGSSGTNKN WFYPYYHVQD HTSDKIVQSF ELHSPLDPSP SSHYSMCYLH  300
SLSNGNSSTS KPTSKAVKLE LPSLQYPETG FGGWGTFPQP PLNESVDVFN QSPLPHAALE  360
SGCSSPHNSG TLEALVYQSK TFPNSKNNSS DKSSHSSTAT PVDRAESSVL NMNETEWEDY  420
TDRASPFGAT SILNECHAVN TNGNSWDKLT PAQNFNGNNV KYEPVDQVST PNSENQPMSL  480
LNITWPDVLL ASDWNDQFMD LRRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-2871396126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004516524.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_004516525.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A072UV520.0A0A072UV52_MEDTR; Myb transcription factor
STRINGGLYMA04G15150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.17e-96myb domain protein 65